PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi1g31280.1.p
Common NameBRADI_1g31280, LOC100823423
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 367aa    MW: 38582.6 Da    PI: 5.8125
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi1g31280.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box185.9e-061354440
          zf-B_box  4 rkCpeHeeke..lqlfCedCqqllCedCllee.Hkg..Htvv 40
                      r+C  +  +   +  +C++C ++lC  C  +  H g  H++v
  Bradi1g31280.1.p 13 RRCGACVGEAaaAAVHCRTCASYLCGVCDAAPeHAGraHERV 54
                      678888854445999****************99*88889875 PP

2zf-B_box22.32.8e-075499342
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                       ++C+ +e  ++   C+ +   lC+ C    H+       H +vp+
  Bradi1g31280.1.p 54 VWVCEVCEASPAAVTCKADAAVLCAACDADVHRAnplaqrHVRVPI 99
                      689*****************************76888888988886 PP

3CCT706e-24290333144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea+l+RY+eKrk+R+FeK+irY+sRKa+AesRpRvKGrF+k++
  Bradi1g31280.1.p 290 REARLTRYREKRKNRRFEKTIRYASRKAYAESRPRVKGRFAKRS 333
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.031056IPR000315B-box-type zinc finger
SMARTSM0033611050IPR000315B-box-type zinc finger
PROSITE profilePS5011910.4955299IPR000315B-box-type zinc finger
SMARTSM003362.6E-135299IPR000315B-box-type zinc finger
PfamPF006435.3E-65399IPR000315B-box-type zinc finger
CDDcd000212.48E-85599No hitNo description
PfamPF062039.9E-18290332IPR010402CCT domain
PROSITE profilePS5101716.847290332IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 367 aa     Download sequence    Send to blast
MMELRKYWGV GGRRCGACVG EAAAAAVHCR TCASYLCGVC DAAPEHAGRA HERVWVCEVC  60
EASPAAVTCK ADAAVLCAAC DADVHRANPL AQRHVRVPIS PILGFHGAAM AMRAPELEEE  120
EEEDLALINL NVEAGKGVKL DLLFSDLVDG PYLGGGGVHD FAARFNGHAD SCLVPSAGAV  180
VEMDFACGIG AAKPPPPSSY GSYTAAAATN SLGHSGSSSE AGVVPEAPIC GAAGSFELDF  240
TRTELQYPAP YNMPMPYTAA PPPPTHCVPA AAAADNMGMV VPAAATGEER EARLTRYREK  300
RKNRRFEKTI RYASRKAYAE SRPRVKGRFA KRSSPGADDD SDEINEAAVP PSSYMLDFGY  360
GVVPSF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560384.20.0PREDICTED: zinc finger protein CONSTANS-LIKE 3
TrEMBLA0A0Q3RVA00.0A0A0Q3RVA0_BRADI; Uncharacterized protein
STRINGBRADI1G31280.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38442348
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15840.18e-38B-box type zinc finger protein with CCT domain